All content
Search filter terms
Filter by category
Filter by type
Filter by tag
Filter by user
Filter by licence
Filter by wsdl
Results per page:
Sort by:
Showing 3 results.
Use the filters on the left and the
search box below to refine the results.
Perform a sequence similarity search using the BLAST algorithm through the DDBJ web service.
Example input for this service are given below.
query:
>MySequence
MATDDSIIVLDDDDEDEAAAQPGPSNLPPNPASTGPGPGLSQQATGLSEPRVDGGSS
NSGSRKCYKLDNEKLFEEFLELCKTETSDHPEVVPFLHKLQQRAQSVFLASAEFCNIL
SRVLARSRKRPAKIYVYINELCTVLKAHSIKKKLNLAPAASTTSEASGPNPPTEPPSDLT
NTENTASEASRTRGSRRQIQRLEQLLALYVAEIRRLQEKELDLSELDDPDSSYLQEAR
LKRKLIRLFGRLCELKDCSSLTGRVIEQRIPYRGTRYPEVNRRIERLINKPGLDTFPDY
GDVLRAVEKAATRHSLGLP...
Created: 2007-10-03 | Last updated: 2009-12-03
Simplify a BLAST text file
(2)
This workflow simplifies a BLAST text file into identifiers, descriptions and values (P, E-values). In order to extract the relevant ids etc. you need to pass the relevant string into the corresponding port, e.g. the default port being used is gi. This has been passed "gi". For any other ports simply pass in the string the SAME as the port name, e.g. seq_id, p, per etc.
Created: 2007-10-03 | Last updated: 2009-07-28
BLASTP with simplified results returned
(2)
Perform a blastp search on protein sequence and extract information based on the user input, e.g. a list of GI numbers. N.B. this workflow does not function correctly as it is designed for use with NCBI blast scripts. Some errors may occur. Please use two blast text file inputs for a secure result output.
Example input for this service are given below.
query:
>MySequence
MATDDSIIVLDDDDEDEAAAQPGPSNLPPNPASTGPGPGLSQQATGLSEPRVDGGSS
NSGSRKCYKLDNEKLFEEFLELCKTETSDHPEVVPFLHKLQQRAQSV...
Created: 2007-10-03 | Last updated: 2009-12-03
Results per page:
Sort by: