SannaWorkflow

Created: 2008-03-07 12:33:13

No description has been set

Information Preview

Information Run

You do not have permission to run this workflow


Information Workflow Components

You do not have permission to see the internals of this workflow

Information Workflow Type

Taverna 1

Information Uploader

Information License

All versions of this Workflow are licensed under:

Information Version 1 (of 1)

Information Credits (1)

(People/Groups)

Information Attributions (0)

(Workflows/Files)

None

Information Tags (0)

None

Log in to add Tags

Information Shared with Groups (0)

None

Information Featured In Packs (0)

None

Log in to add to one of your Packs

Information Attributed By (0)

(Workflows/Files)

None

Information Favourited By (0)

No one

 

Citations (0)

None


Version History

In chronological order:



Reviews Reviews (1)

By

Review Title:

Rating: 5 out of 5

Created: 2008-03-07 12:35:22 | Updated: 2008-03-07 12:35:22

This is a great workflow.

[ more ]

Show View


Comments Comments (9)

Log in to make a comment

  • Monday 26 July 2010 21:10:15 (UTC)
    This is my comment.
  • Monday 26 July 2010 22:22:10 (UTC)
    GINNY%20COMMENT
  • Monday 26 July 2010 23:34:21 (UTC)
    test
  • Monday 26 July 2010 23:45:30 (UTC)
    test
  • Monday 26 July 2010 23:52:35 (UTC)
    aa
  • Monday 26 July 2010 23:59:44 (UTC)
    s
  • Tuesday 27 July 2010 09:38:43 (UTC)
    a
  • Tuesday 27 July 2010 09:54:07 (UTC)
    my
  • Thursday 29 July 2010 12:11:18 (UTC)
    this%20is%20my%20comment



Workflow Other workflows that use similar services (50)

Only the first 2 workflows that use similar services are shown. View all workflows that use these services.


Workflow BLASTP with simplified results returned (2)

Thumb
Perform a blastp search on protein sequence and extract information based on the user input, e.g. a list of GI numbers. N.B. this workflow does not function correctly as it is designed for use with NCBI blast scripts. Some errors may occur. Please use two blast text file inputs for a secure result output.   Example input for this service are given below. query: >MySequence MATDDSIIVLDDDDEDEAAAQPGPSNLPPNPASTGPGPGLSQQATGLSEPRVDGGSS NSGSRKCYKLDNEKLFEEFLELCKTETSDHPEVVPFLHKLQQRAQSV...

Created: 2007-10-03 | Last updated: 2009-12-03

Workflow BLAST using DDBJ service (2)

Thumb
Perform a sequence similarity search using the BLAST algorithm through the DDBJ web service.   Example input for this service are given below. query: >MySequence MATDDSIIVLDDDDEDEAAAQPGPSNLPPNPASTGPGPGLSQQATGLSEPRVDGGSS NSGSRKCYKLDNEKLFEEFLELCKTETSDHPEVVPFLHKLQQRAQSVFLASAEFCNIL SRVLARSRKRPAKIYVYINELCTVLKAHSIKKKLNLAPAASTTSEASGPNPPTEPPSDLT NTENTASEASRTRGSRRQIQRLEQLLALYVAEIRRLQEKELDLSELDDPDSSYLQEAR LKRKLIRLFGRLCELKDCSSLTGRVIEQRIPYRGTRYPEVNRRIERLINKPGLDTFPDY GDVLRAVEKAATRHSLGLP...

Created: 2007-10-03 | Last updated: 2009-12-03