Back translate a protein sequence into a dna sequence

Created: 2007-10-03 18:36:03      Last updated: 2009-12-03 16:18:43

This workflow back translates a protein sequence into a DNA sequence.

Example input for this workflow is:

MATDDSIIVLDDDDEDEAAAQPGPSNLPPNPASTGPGPGLSQQATGLSEPRVDGGSSNSG
SRKCYKLDNEKLFEEFLELCKTETSDHPEVVPFLHKLQQRAQSVFLASAEFCNILSRVLA
RSRKRPAKIYVYINELCTVLKAHSIKKKLNLAPAASTTSEASGPNPPTEPPSDLTNTENT
ASEASRTRGSRRQIQRLEQLLALYVAEIRRLQEKELDLSELDDPDSSYLQEARLKRKLIR
LFGRLCELKDCSSLTGRVIEQRIPYRGTRYPEVNRRIERLINKPGLDTFPDYGDVLRAVE
KAATRHSLGLPRQQLQLLAQDAFRDVGVRLQERRHLDLIYNFGCHLTDDYRPGVDPALSD
PTLARRLRENRTLAMNRLDEVISKYAMMQDKTEEGERQKRRARLLGTAPQPSDPPKASSE
SGEGPSGMASQECPTTSKAETDDDDDDDDDDDDEDNEESEEEEEEEEEEKEATEDEDEDL
EQLQEDQGGDEEEEGGDNEGNESPTSPSDFFHRRNSEPAEGLRTPEGQQKRGLTETPASP
PGASLDPPSTDAESSGEQLLEPLLGDESPVSQLAELEMEALPEERDISSSRKKSEDSLPT
ILENGAAVVTSTSVNGRVSSHTWRDASPPSKRFRKEKKQLGSGLLGNSYIKEPMAQQDSG
QNTSVQPMPSPPLASVASVADSSTRVDSPSHELVTSSLCSPSPSLLLQTPQAQSLRQCIY
KTSVATQCDPEEIIVLSDSD

Information Preview

Information Run

Run this Workflow in the Taverna Workbench...

Option 1:

Copy and paste this link into File > 'Open workflow location...'
https://www.myexperiment.org/workflows/18/download?version=2
[ More InfoExpand ]


Information Workflow Components

Inputs (1)
Processors (1)
Beanshells (0)
Outputs (1)
Links (2)
Coordinations (0)

Information Workflow Type

Taverna 1

Information Uploader

Information License

All versions of this Workflow are licensed under:

Information Version 2 (latest) (of 2)

View version:

Information Credits (0)

(People/Groups)

None

Information Attributions (0)

(Workflows/Files)

None

Information Tags (0)

None

Log in to add Tags

Information Shared with Groups (0)

None

Information Featured In Packs (0)

None

Log in to add to one of your Packs

Information Attributed By (0)

(Workflows/Files)

None

Information Favourited By (0)

No one

Information Statistics

 

Citations (0)

None


Version History

In chronological order:



Reviews Reviews (0)

No reviews yet

Be the first to review!



Comments Comments (0)

No comments yet

Log in to make a comment




Workflow Other workflows that use similar services (0)

There are no workflows in myExperiment that use similar services to this Workflow.