Log in
Register
Give us Feedback
InviteWorkflow Entry: EBI NCBI Blast
| Citations (0) | Version History | Reviews (0) | Comments (3) |
 Version 2 (latest)
(of 2)
|
Version created on:
03/10/07 @ 18:36:22
by:
Hong Chang Bum
|
Revision comments 
Title: EBI NCBI Blast
Type: Taverna 1
Preview
(Click on the image to get the full size)
Download Scalable Diagram (SVG)
Description
EBI NCBI Blast
Download
Run
Run this Workflow in the Taverna Workbench...
Option 1:
Launch in TavernaNote: you need to have both the WHIP Launcher and the Taverna myExperiment/WHIP plugin installed on your machine for this to work. See here for information.
Option 2:
Copy and paste this link into File > 'Open workflow location...'
http://www.myexperiment.org/workflows/39/download?version=2
[ More Info ]
Workflow Components
Workflow Type
Log in to add Tags
Shared with Groups (0)
None
Current:
0.0 / 5
(0 ratings)
Log in to rate and see breakdown of ratings
Statistics
None
Earliest Version:
[1] - ebi_ncbi
Latest Version:
[2] - EBI NCBI Blast
Reviews
(0)
Other workflows that use similar services
(3)
Only the first 2 workflows that use similar services are shown. View all workflows that use these services.
|
Original Uploader |
Created: 31/05/08 @ 08:38:46 | Last updated: 06/12/10 @ 10:54:16
Credits:
License: Creative Commons Attribution 3.0 Unported License
Perform a BLAST search using the EBI’s WSNCBIBlast service (see http://www.ebi.ac.uk/Tools/webservices/services/ncbiblast). The query sequence, database to search and BLAST program to use are inputs, the other parameters for the search (see Job_params) are allowed to default.
Note: the WSNCBIBlast service used by this workflow is deprecated as of 21st September 2010 and should not be used in any new development. This service is will be retired during 2011. EBI's replacement NCBI BLA...
Rating: 0.0 / 5 (0 ratings) | Versions: 1 | Reviews: 0 | Comments: 1 | Citations: 0 Viewed: 312 times | Downloaded: 154 times Tags (6): |
 View
 Download (v1)
|
|
Original Uploader |
Created: 26/10/08 @ 21:10:09 | Last updated: 01/04/11 @ 08:54:21
Credits:
Attributions:
License: Creative Commons Attribution 3.0 Unported License
Note: the WSInterProScan web service used by this workflow is no longer available haveing been replaced by the EMBL-EBI's InterProScan (REST) (http://www.ebi.ac.uk/Tools/webservices/services/pfa/iprscan_rest) and InterProScan (SOAP) (http://www.ebi.ac.uk/Tools/webservices/services/pfa/iprscan_soap) web services. Thus the workflow described here no longer works, see the alternative workflows for the InterProScan (SOAP) service for workflows which use the new services.
Run InterProScan using a...
Rating: 0.0 / 5 (0 ratings) | Versions: 4 | Reviews: 0 | Comments: 0 | Citations: 0 Viewed: 358 times | Downloaded: 119 times Tags (11): |
View
Download (v4)
|
Linked Data
Non-Information Resource URI: http://www.myexperiment.org/workflows/39
Alternative Formats
Copyright © 2007 - 2011 The University of Manchester and University of Southampton
Log in to make a comment
Workflow as it is now does not work.
"Sequence" should only be linked to the "content" input parameter of WSArrayofDataXML splitter and not to the "database" input parameter of the paramsXML splitter.
At least 3 extra parameters need to be created: "database" and "program" linked to corresponding parameters of paramsXML and "type" linked to the corresponding input parameter of WSArrayofDataXML.
Test the workflow with the following parameter it should work. it only does a blastp.
input example:
>gi|37927048|pdb|1NYC|A Chain A, Staphostatins Resemble Lipocalins, Not Cystatins In Fold.
GSMYQLQFINLVYDTTKLTHLEQTNINLFIGNWSNHQLQKSICIRHGDDTSHNQYHILFIDTAHQRIKFS
SFDNEEIIYILDYDDTQHILMQTSSKQGIGTSRPIVYERLV