Workflows
Search filter terms
Filter by type
Filter by tag
Filter by user
Filter by licence
Filter by wsdl
Results per page:
Sort by:
Showing 3 results.
Use the filters on the left and the
search box below to refine the results.
Perform a sequence similarity search using the BLAST algorithm through the DDBJ web service.
Example input for this service are given below.
query:
>MySequence
MATDDSIIVLDDDDEDEAAAQPGPSNLPPNPASTGPGPGLSQQATGLSEPRVDGGSS
NSGSRKCYKLDNEKLFEEFLELCKTETSDHPEVVPFLHKLQQRAQSVFLASAEFCNIL
SRVLARSRKRPAKIYVYINELCTVLKAHSIKKKLNLAPAASTTSEASGPNPPTEPPSDLT
NTENTASEASRTRGSRRQIQRLEQLLALYVAEIRRLQEKELDLSELDDPDSSYLQEAR
LKRKLIRLFGRLCELKDCSSLTGRVIEQRIPYRGTRYPEVNRRIERLINKPGLDTFPDY
GDVLRAVEKAATRHSLGLP...
Created: 2007-10-03 | Last updated: 2009-12-03
KEGG pathways common to both QTL and micro... (3)
This workflow takes in two lists of KEGG pathway ids. These are designed to come from pathways found from genes in a QTL (Quantitative Trait Loci) region, and from pathways found from genes differentially expressed in a microarray study. By identifying the intersecting pathways from both studies, a more informative picture is obtained of the candidate processes involved in the expression of a phenotype.
Example input for this workflow is given below (as newline separated values).
qt...
Created: 2009-11-24 | Last updated: 2009-12-03
BLASTP with simplified results returned (2)
Perform a blastp search on protein sequence and extract information based on the user input, e.g. a list of GI numbers. N.B. this workflow does not function correctly as it is designed for use with NCBI blast scripts. Some errors may occur. Please use two blast text file inputs for a secure result output.
Example input for this service are given below.
query:
>MySequence
MATDDSIIVLDDDDEDEAAAQPGPSNLPPNPASTGPGPGLSQQATGLSEPRVDGGSS
NSGSRKCYKLDNEKLFEEFLELCKTETSDHPEVVPFLHKLQQRAQSV...
Created: 2007-10-03 | Last updated: 2009-12-03
Results per page:
Sort by: