Tag Results

Items tagged with "BLAST" (25)

Note: some items may not be visible to you, due to viewing permissions.


Packs (1)

Creator:

Pack Package: mapping oligonucleotides to an assembly

Created: 11/12/08 @ 12:02:48 | Last updated: 22/01/09 @ 09:06:27

This package contains all elements required to run the RShell use case "Mapping oligonucleotides to an assembly"  

5 items in this pack

Comments: 0 | Viewed: 108 times | Downloaded: 31 times

Tags:

Show View Download Download
Workflows (24)
Taverna 1

Original Uploader

Workflow BLAST using DDBJ service (v2)

Created: 03/10/07 @ 18:36:06 | Last updated: 03/12/09 @ 16:31:21

License: Creative Commons Attribution-No Derivative Works 3.0 Unported License

Blast_using_ddbj_service_29247
Perform a sequence similarity search using the BLAST algorithm through the DDBJ web service.   Example input for this service are given below. query: >MySequence MATDDSIIVLDDDDEDEAAAQPGPSNLPPNPASTGPGPGLSQQATGLSEPRVDGGSS NSGSRKCYKLDNEKLFEEFLELCKTETSDHPEVVPFLHKLQQRAQSVFLASAEFCNIL SRVLARSRKRPAKIYVYINELCTVLKAHSIKKKLNLAPAASTTSEASGPNPPTEPPSDLT NTENTASEASRTRGSRRQIQRLEQLLALYVAEIRRLQEKELDLSELDDPDSSYLQEAR LKRKLIRLFGRLCELKDCSSLTGRVIEQRIPYRGTRYPEVNRRIERLINKPGLDTFPDY GDVLRAVEKAATRHSLGLP...

Rating: 4.5 / 5 (2 ratings) | Versions: 2 | Reviews: 0 | Comments: 0 | Citations: 0

Viewed: 367 times | Downloaded: 134 times

Tags (5):

Show View Download Download (v2)

Taverna 1

Original Uploader

Workflow BLASTP with simplified results returned (v2)

Created: 03/10/07 @ 18:36:06 | Last updated: 03/12/09 @ 16:28:51

License: Creative Commons Attribution-No Derivative Works 3.0 Unported License

Blastp_with_simplified_results_returned_28648
Perform a blastp search on protein sequence and extract information based on the user input, e.g. a list of GI numbers. N.B. this workflow does not function correctly as it is designed for use with NCBI blast scripts. Some errors may occur. Please use two blast text file inputs for a secure result output.   Example input for this service are given below. query: >MySequence MATDDSIIVLDDDDEDEAAAQPGPSNLPPNPASTGPGPGLSQQATGLSEPRVDGGSS NSGSRKCYKLDNEKLFEEFLELCKTETSDHPEVVPFLHKLQQRAQSV...

Rating: 4.0 / 5 (1 rating) | Versions: 2 | Reviews: 0 | Comments: 0 | Citations: 0

Viewed: 226 times | Downloaded: 66 times

Tags (6):

Show View Download Download (v2)

Taverna 1

Original Uploader

Workflow Simplify a BLAST text file (v2)

Created: 03/10/07 @ 18:36:06 | Last updated: 28/07/09 @ 13:01:46

License: Creative Commons Attribution-No Derivative Works 3.0 Unported License

Simpliy_a_blast_text_file_23463
This workflow simplifies a BLAST text file into identifiers, descriptions and values (P, E-values). In order to extract the relevant ids etc. you need to pass the relevant string into the corresponding port, e.g. the default port being used is gi. This has been passed "gi". For any other ports simply pass in the string the SAME as the port name, e.g. seq_id, p, per etc.

Rating: 4.0 / 5 (1 rating) | Versions: 2 | Reviews: 0 | Comments: 0 | Citations: 0

Viewed: 243 times | Downloaded: 109 times

Tags (11):

Show View Download Download (v2)

Taverna 1

Original Uploader

Workflow Multiple Blastp (v2)

Created: 20/11/07 @ 16:58:38 | Last updated: 10/01/08 @ 12:09:38

Credits: User Kieren Lythgow

License: Creative Commons Attribution-Share Alike 3.0 Unported License

Multiple_blastp_7288_2
This is a workflow to automate multiple BLASTp jobs on a large list of protein sequences in FASTA format.

Rating: 5.0 / 5 (1 rating) | Versions: 2 | Reviews: 0 | Comments: 1 | Citations: 0

Viewed: 287 times | Downloaded: 107 times

Tags (4):

Show View Download Download (v2)

Taverna 1

Original Uploader

Workflow Workflow for Protein Sequence Analysis (v1)

Created: 09/01/08 @ 12:03:04 | Last updated: 09/01/08 @ 12:31:29

Credits: User M.B.Monteiro

Attributions: Workflow BLAST using DDBJ service Workflow Simplify a BLAST text file Workflow conditional branch

License: Creative Commons Attribution-Share Alike 3.0 Unported License

Workflow_for_protein_sequence_analysis_5539_1
This workflow performs a generic protein sequence analysis. In order to do that a novel protein sequence enters into the software along with a list of known protein identifiers chosen by the biologist to perform a homology search, followed by a multiple sequence alignment and finally a phylogenetic analysis.

Rating: 3.0 / 5 (1 rating) | Versions: 1 | Reviews: 0 | Comments: 0 | Citations: 0

Viewed: 720 times | Downloaded: 243 times

Tags (10):

Show View Download Download (v1)

Taverna 1

Original Uploader

Workflow BLASTP with simplified results returned (v2)

Created: 03/10/07 @ 18:36:12 | Last updated: 06/03/08 @ 17:01:32

License: Creative Commons Attribution-No Derivative Works 3.0 Unported License

Blastp_with_simplified_results_returned_14277
This workflow Performs a blastp search on protein sequence, extracts sequence id within the blast report and retrives the corresponding seuqences.

Rating: 4.0 / 5 (2 ratings) | Versions: 2 | Reviews: 0 | Comments: 2 | Citations: 0

Viewed: 144 times | Downloaded: 36 times

Tags (3):

Show View Download Download (v2)

Taverna 1

Original Uploader

Workflow EBI_blastpgp_PSI-BLAST (v1)

Created: 31/05/08 @ 14:39:23

Credits: User Hamish McWilliam

License: Creative Commons Attribution 3.0 Unported License

Ebi_blastpgp_psi-blast_11519_1
Perform a PSI-BLAST iterative search using the EBI’s WSBlastpgp service (see http://www.ebi.ac.uk/Tools/webservices/services/blastpgp). The query sequence, database to search and users e-mail address are inputs, the other parameters for the search (see Job_params) are allowed to default. In most cases you will probably want to adjust the expectation thresholds and the maximum number of iterations for your specific query sequence and the database being searched.

Rating: 0.0 / 5 (0 ratings) | Versions: 1 | Reviews: 0 | Comments: 0 | Citations: 0

Viewed: 95 times | Downloaded: 43 times

Tags (7):

Show View Download Download (v1)

Taverna 1

Original Uploader

Workflow Protein_search_fetch_align_tree (v2)

Created: 31/05/08 @ 21:09:18 | Last updated: 07/04/09 @ 20:13:20

Credits: User Hamish McWilliam

Attributions: Workflow EBI_ClustalW2 Workflow EBI_ClustalW2_phylogentic_tree Workflow EBI_dbfetch_fetchBatch Workflow EBI_WU-BLAST

License: Creative Commons Attribution 3.0 Unported License

Protein_search_fetch_align_tree
An implmentation of the classical sequence analysis workflow: Find homologues (sequence similarity search) Fetch homologues Align homologues (multiple sequence alignment) Produce phylogenetic tree In this implementation the EBI webservices are used: WU-BLAST (WSWUBlast) blastp vs. UniProtKB dbfetch (WSDbfetch) ClustalW (WSClustalW2) ClustalW (WSClustalW2) Note: this version does not add the inital query sequence to the alignment, and so is most useful when used with the identifers...

Rating: 0.0 / 5 (0 ratings) | Versions: 2 | Reviews: 0 | Comments: 0 | Citations: 0

Viewed: 242 times | Downloaded: 78 times

Tags (15):

Show View Download Download (v2)

Taverna 1

Original Uploader

Workflow EBI_WU-BLAST (v1)

Created: 30/05/08 @ 22:47:19 | Last updated: 02/06/08 @ 21:30:18

Credits: User Hamish McWilliam

License: Creative Commons Attribution 3.0 Unported License

Ebi_wu-blast_31786_1
Perform a BLAST search using the EBI's WSWUBlast service (see http://www.ebi.ac.uk/Tools/webservices/services/wublast). The default parameters search UniProtKB using blastp. To change the job parameters see Job_params.

Rating: 0.0 / 5 (0 ratings) | Versions: 1 | Reviews: 0 | Comments: 0 | Citations: 0

Viewed: 163 times | Downloaded: 56 times

Tags (5):

Show View Download Download (v1)

Taverna 1

Original Uploader

Workflow EBI WU-BLAST with program and database selection prompts. (v3)

Created: 30/05/08 @ 22:56:50 | Last updated: 04/07/09 @ 11:39:55

Credits: User Hamish McWilliam

Attributions: Workflow EBI_WU-BLAST

License: Creative Commons Attribution 3.0 Unported License

Ebi_wu-blast_with_program_and_database_selection_prompts
Run a BLAST analysis using the EBI's WSWUBlast service (see http://www.ebi.ac.uk/Tools/webservices/services/wublast). This workflow wraps the EBI_WU-BLAST workflow to provide a basic user interface which prompts for the required inputs: sequence, database, BLAST program and user e-mail. Other parameters (e.g. matrix, sort, gap penalties, etc.) are allowed to default. The values presented in the selection menus for the program and database are obtained from the service, using the provided me...

Rating: 0.0 / 5 (0 ratings) | Versions: 3 | Reviews: 0 | Comments: 0 | Citations: 0

Viewed: 110 times | Downloaded: 49 times

Tags (6):

Show View Download Download (v3)

Taverna 1

Original Uploader

Workflow EBI_NCBI_BLAST (v1)

Created: 31/05/08 @ 08:38:49 | Last updated: 02/06/08 @ 21:32:22

Credits: User Hamish McWilliam

License: Creative Commons Attribution 3.0 Unported License

Ebi_ncbi_blast_8105_1
Perform a BLAST search using the EBI’s WSNCBIBlast service (see http://www.ebi.ac.uk/Tools/webservices/services/ncbiblast). The query sequence, database to search and BLAST program to use are inputs, the other parameters for the search (see Job_params) are allowed to default.

Rating: 0.0 / 5 (0 ratings) | Versions: 1 | Reviews: 0 | Comments: 1 | Citations: 0

Viewed: 180 times | Downloaded: 95 times

Tags (6):

Show View Download Download (v1)

Taverna 1

Original Uploader

Workflow EBI_NCBI_BLAST_with_prompts (v1)

Created: 31/05/08 @ 08:40:30 | Last updated: 02/06/08 @ 21:32:49

Credits: User Hamish McWilliam

Attributions: Workflow EBI_NCBI_BLAST

License: Creative Commons Attribution 3.0 Unported License

Ebi_ncbi_blast_with_prompts_25022_1
Run a BLAST analysis using the EBI’s WSNCBIBlast service (see http://www.ebi.ac.uk/Tools/webservices/services/ncbiblast). This workflow wraps the EBI_NCBI_BLAST workflow to provide a basic user interface which prompts for the required inputs: sequence, database, BLAST program and user e-mail. Other parameters (e.g. matrix, sort, gap penalties, etc.) are allowed to default.

Rating: 0.0 / 5 (0 ratings) | Versions: 1 | Reviews: 0 | Comments: 0 | Citations: 0

Viewed: 77 times | Downloaded: 47 times

Tags (7):

Show View Download Download (v1)

Taverna 1

Original Uploader

Workflow Retrieve Protein Sequence and BLAST (v1)

Created: 09/11/07 @ 10:41:12 | Last updated: 05/06/08 @ 15:18:08

Credits: User Katy Wolstencroft

License: Creative Commons Attribution-Share Alike 3.0 Unported License

Retrieve_protein_sequence_13844
Retrieves a protein sequence in Fasta format from Genbank and then performs a BLAST on that sequence

Rating: 4.0 / 5 (2 ratings) | Versions: 1 | Reviews: 0 | Comments: 0 | Citations: 0

Viewed: 235 times | Downloaded: 12 times

Tags (6):

Show View

Taverna 1

Original Uploader

Workflow Nucleotide_InterProScan (v4)

Created: 06/06/08 @ 21:45:10 | Last updated: 26/10/08 @ 21:10:10

Credits: User Hamish McWilliam

Attributions: Workflow EBI_InterProScan Workflow EBI_NCBI_BLAST Workflow Nucleotide_ORF_translation Workflow Fasta_string_to_fasta_list Workflow Sequence_or_ID

License: Creative Commons Attribution 3.0 Unported License

Nucleotide_interproscan
Run InterProScan using a nucleotide sequence as input. The InterProScan tool (http://www.ebi.ac.uk/Tools/InterProScan/) searches a protein sequence against a selection of protein domain, feature and family signature databases, and integrates the results giving potential assignments to InterPro entries and Gene Ontology terms. Since InterProScan is a protein search tool to use it with a nucleotide sequence, the sequence must be translated into a protein sequence. There are a number of ways of...

Rating: 0.0 / 5 (0 ratings) | Versions: 4 | Reviews: 0 | Comments: 0 | Citations: 0

Viewed: 140 times | Downloaded: 58 times

Tags (11):

Show View Download Download (v4)

Taverna 1

Original Uploader

Workflow EBI_Blast2InterPro (v2)

Created: 07/06/08 @ 10:52:47 | Last updated: 26/10/08 @ 20:45:46

Credits: User Hamish McWilliam

Attributions: Workflow EBI_WU-BLAST Workflow EBI_dbfetch_fetchBatch Workflow Fasta_string_to_fasta_list Workflow EBI_InterProScan

License: Creative Commons Attribution 3.0 Unported License

Ebi_blast2interpro
Perform a BLAST search add information about the InterPro matches associated with the hits. This implementation uses: EBI’s WSWUBlast web service (http://www.ebi.ac.uk/Tools/webservices/services/wublast) to perform the initial BLAST search against UniProtKB. EBI’s WSDbfetch web service (http://www.ebi.ac.uk/Tools/webservices/services/dbfetch) to retreive the sequences of the hits found by BLAST. 3. EBI’s WSInterProScan web service (http://www.ebi.ac.uk/Tools/webservices/services/interp...

Rating: 0.0 / 5 (0 ratings) | Versions: 2 | Reviews: 0 | Comments: 0 | Citations: 0

Viewed: 123 times | Downloaded: 52 times

Tags (11):

Show View Download Download (v2)

Taverna 1

Original Uploader

Workflow NCBI_QBLAST (v2)

Created: 07/06/08 @ 15:05:01 | Last updated: 07/06/08 @ 17:11:36

Credits: User Hamish McWilliam

License: Creative Commons Attribution 3.0 Unported License

Ncbi_qblast_32544_2
Perform an NCBI BLAST sequence similarity search using NCBI's QBLAST service (see http://www.ncbi.nlm.nih.gov/BLAST/Doc/urlapi.html). The query sequence, database to search and BLAST program to use are inputs, the other parameters for the search are allowed to default.

Rating: 0.0 / 5 (0 ratings) | Versions: 2 | Reviews: 0 | Comments: 0 | Citations: 0

Viewed: 102 times | Downloaded: 48 times

Tags (5):

Show View Download Download (v2)

Taverna 1

Original Uploader

Workflow Blast against ENSEMBLE Danio_rerio_Genome (v1)

Created: 15/10/08 @ 08:43:51 | Last updated: 15/10/08 @ 09:21:36

Credits: User Wassinki

License: Creative Commons Attribution-Share Alike 3.0 Unported License

Blast
This workflow invokes the blast service provided at www.bioinformatics.nl, written by Pieter Neerincx. The workflow takes as input a database name (Danio_rerio_Genome for Zebra Fish for example) and a set of sequences in fasta format. The blast service is invoked (using polling) and the result is a tab separated blast report.   To run this workflow, a certificate to access www.bioinformatics.nl needs to installed (Some services use an SSL connection). Look at the link below how to ins...

Rating: 0.0 / 5 (0 ratings) | Versions: 1 | Reviews: 0 | Comments: 0 | Citations: 0

Viewed: 59 times | Downloaded: 26 times

Tags (1):

Show View Download Download (v1)

Taverna 1

Original Uploader

Workflow BlatBlastCombi (v2)

Created: 15/10/08 @ 08:44:24 | Last updated: 03/02/09 @ 08:28:07

Credits: User Wassinki

License: Creative Commons Attribution-Share Alike 3.0 Unported License

Blatblastcombi
This workflow combines the blat and blast workflows. It takes as input a database name (Danio_rerio_Genome for Zebra Fish for example) and and a set of Fasta sequences. It first tries to perform a blat (at www.bioinformatics.nl). When this service returns nothing, a blast is done (also at www.bioinformatics.nl). The resulting reports are combined.   To run this workflow, a certificate to access www.bioinformatics.nl needs to installed (Some services use an SSL connection). Look at the ...

Rating: 0.0 / 5 (0 ratings) | Versions: 2 | Reviews: 0 | Comments: 0 | Citations: 0

Viewed: 76 times | Downloaded: 41 times

Tags (3):

Show View Download Download (v2)

Taverna 1

Original Uploader

Workflow blastp using the MRS system (v1)

Created: 28/11/08 @ 15:13:32 | Last updated: 28/11/08 @ 15:34:20

Credits: User Bas Vroling

License: Creative Commons Attribution 3.0 Unported License

Blastp_using_the_mrs_system
This blastp workflow uses the blast service of MRS (http://mrs.cmbi.ru.nl). Inputs are a sequence (only amino acids, not a fasta sequence) and a database name. Valid database names that can be used are "sprot", "uniprot", "trembl", "pdb", "refseq", "ipi" and "gpcrdb". Output is returned in XML.

Rating: 0.0 / 5 (0 ratings) | Versions: 1 | Reviews: 0 | Comments: 0 | Citations: 0

Viewed: 63 times | Downloaded: 22 times

Tags (4):

Show View Download Download (v1)

Taverna 1

Original Uploader

Workflow Multi sequences NCBI BLAST (v1)

Created: 05/12/08 @ 02:57:22

Credits: User Whybiocc

Attributions: Workflow EBI_NCBI_BLAST Workflow EBI_NCBI_BLAST_with_prompts Workflow EBI_Blast2InterPro

License: Creative Commons Attribution-Share Alike 3.0 Unported License

Multi_sequences_ncbi_blast
Run a BLAST analysis using the EBI's WSNCBIBlast service (see http://www.ebi.ac.uk/Tools/webservices/services/ncbiblast). This workflow wraps the EBI_NCBI_BLAST workflow to provide a basic user interface which prompts for the required inputs: sequence file, database, BLAST program and user e-mail. Other parameters (e.g. matrix, sort, gap penalties, etc.) are allowed to default.

Rating: 0.0 / 5 (0 ratings) | Versions: 1 | Reviews: 0 | Comments: 0 | Citations: 0

Viewed: 100 times | Downloaded: 60 times

Tags (1):

Show View Download Download (v1)

Taverna 1

Original Uploader

Workflow Mapping OligoNucleotides to an assembly (v7)

Created: 11/12/08 @ 12:11:59 | Last updated: 13/02/09 @ 09:08:23

Credits: User Wassinki User Pieter Neerincx

Attributions: Workflow Blat against ENSEMBLE Danio_rerio_Genome Workflow BlatBlastCombi Workflow Blast against ENSEMBLE Danio_rerio_Genome Workflow AppendToFile Blob Test Input for Mapping oligonucleotides to an assembly Blob Input for Mapping oligonucleotides to an assembly

License: Creative Commons Attribution-Share Alike 3.0 Unported License

Mapping_oligonucleotides_to_an_assembly
Version info The former version of the workflow expected that results from BioMART only report transcripts when the query (the probe in our case) are entirely encapsulated in an exon of that transcript. However, the BioMart service also returns transcripts when the query is not or only partially overlapping with an exon in the stretch on the assembly on which a transcript is defined. This resulted in too many oligos classified as having multiple transcripts or having multiple genes. ...

Rating: 0.0 / 5 (0 ratings) | Versions: 7 | Reviews: 0 | Comments: 0 | Citations: 0

Viewed: 207 times | Downloaded: 41 times

Tags (7):

Show View Download Download (v7)

Taverna 1

Original Uploader

Workflow Identify_strain_and_phylogenetic_tree (v1)

Created: 20/03/09 @ 15:20:36 | Last updated: 20/03/09 @ 15:22:26

Credits: User Aailyso User Hamish McWilliam Network-member AID

License: Creative Commons Attribution-Share Alike 3.0 Unported License

Whole
No description

Rating: 0.0 / 5 (0 ratings) | Versions: 1 | Reviews: 0 | Comments: 0 | Citations: 0

Viewed: 132 times | Downloaded: 28 times

Tags (6):

Show View Download Download (v1)

BioExtract Server

Original Uploader

Workflow Nucleotide InterProScan for the BioExtract Server (v3)

Created: 14/01/09 @ 16:53:47 | Last updated: 01/07/09 @ 08:32:35

Credits: User Carol Lushbough User Hamish McWilliam

Attributions: Workflow Nucleotide_InterProScan

License: Creative Commons Attribution-Share Alike 3.0 Unported License

Interproscan
This workflow can be downloaded and imported into the BioExtract Server at bioextract.org. This workflow is a BioExtract Server process similar to the Nucleotide InterProScan workflow designed and implement in Taverna by Hamish McWilliams. The InterProScan tool (http://www.ebi.ac.uk/Tools/InterProScan/) searches a protein sequence against a selection of protein domain, feature and family signature databases, and integrates the results giving potential assignments to InterPro entries and Gen...

Rating: 0.0 / 5 (0 ratings) | Versions: 3 | Reviews: 0 | Comments: 0 | Citations: 0

Viewed: 93 times | Downloaded: 69 times

Tags (5):

Show View Download Download (v3)

Taverna 1

Original Uploader

Workflow fetchEnsemblSeqsAndBlast (v1)

Created: 18/04/08 @ 11:53:19 | Last updated: 18/04/08 @ 11:58:31

Credits: User Bela

License: Creative Commons Attribution-Share Alike 3.0 Unported License

Fetchensemblseqsandblast_12435_1
This workflow allows you to configure a BioMart query to fetch sequences you want from Ensembl. These sequences are retrieved and a blast database of them is created (by default, in the directory you ran taverna from). Warning: This workflow assumes that you have blastall and formatdb installed on the machine, and that by default, these are both found or linked in /usr/local/bin. It also assumes that you have write permission to the directory you have run taverna from. The beanshells "creat...

Rating: 0.0 / 5 (0 ratings) | Versions: 1 | Reviews: 0 | Comments: 0 | Citations: 0

Viewed: 126 times | Downloaded: 24 times

Tags (1):

Show View Download Download (v1)

New/Upload

Log in / Register

Username or Email:

Password:

Remember me:

OR

Use OpenID:


(eg: name.myopenid.com)

Need an account?
Click here to register

Forgot Password?

Front Page

Home

Invite people to myExperiment

Help pages

About Us

News and Events

Mailing List

Contact Us

Developers

Publications


Taverna Workflow Workbench

myGrid

BioCatalogue

Trident

Google Coop Search

EPSRC

JISC

Microsoft

Powered by:

Rails

Icons:
Silk icon set 1.3