Note: some items may not be visible to you, due to viewing permissions.
|
Original Uploader |
Created: 03/10/07 @ 18:36:06 | Last updated: 03/12/09 @ 16:31:20 License: Creative Commons Attribution-No Derivative Works 3.0 Unported License
Perform a sequence similarity search using the BLAST algorithm through the DDBJ web service.
Example input for this service are given below.
query:
>MySequence
MATDDSIIVLDDDDEDEAAAQPGPSNLPPNPASTGPGPGLSQQATGLSEPRVDGGSS
NSGSRKCYKLDNEKLFEEFLELCKTETSDHPEVVPFLHKLQQRAQSVFLASAEFCNIL
SRVLARSRKRPAKIYVYINELCTVLKAHSIKKKLNLAPAASTTSEASGPNPPTEPPSDLT
NTENTASEASRTRGSRRQIQRLEQLLALYVAEIRRLQEKELDLSELDDPDSSYLQEAR
LKRKLIRLFGRLCELKDCSSLTGRVIEQRIPYRGTRYPEVNRRIERLINKPGLDTFPDY
GDVLRAVEKAATRHSLGLP...
Rating: 4.5 / 5 (2 ratings) | Versions: 2 | Reviews: 0 | Comments: 1 | Citations: 0 Viewed: 541 times | Downloaded: 199 times Tags (5): |
View
Download (v2)
|
|
Original Uploader |
Created: 03/10/07 @ 18:36:06 | Last updated: 03/12/09 @ 16:28:50 License: Creative Commons Attribution-No Derivative Works 3.0 Unported License
Perform a blastp search on protein sequence and extract information based on the user input, e.g. a list of GI numbers. N.B. this workflow does not function correctly as it is designed for use with NCBI blast scripts. Some errors may occur. Please use two blast text file inputs for a secure result output.
Example input for this service are given below.
query:
>MySequence
MATDDSIIVLDDDDEDEAAAQPGPSNLPPNPASTGPGPGLSQQATGLSEPRVDGGSS
NSGSRKCYKLDNEKLFEEFLELCKTETSDHPEVVPFLHKLQQRAQSV...
Rating: 4.0 / 5 (1 rating) | Versions: 2 | Reviews: 0 | Comments: 0 | Citations: 0 Viewed: 309 times | Downloaded: 102 times Tags (6): |
View
Download (v2)
|
|
Original Uploader |
Created: 03/10/07 @ 18:36:06 | Last updated: 28/07/09 @ 13:01:45 License: Creative Commons Attribution-No Derivative Works 3.0 Unported License
This workflow simplifies a BLAST text file into identifiers, descriptions and values (P, E-values). In order to extract the relevant ids etc. you need to pass the relevant string into the corresponding port, e.g. the default port being used is gi. This has been passed "gi". For any other ports simply pass in the string the SAME as the port name, e.g. seq_id, p, per etc.
Rating: 4.0 / 5 (1 rating) | Versions: 2 | Reviews: 0 | Comments: 0 | Citations: 0 Viewed: 335 times | Downloaded: 137 times Tags (11): |
View
Download (v2)
|
|
Original Uploader |
Created: 20/11/07 @ 16:58:38 | Last updated: 10/01/08 @ 12:09:38
Credits:
License: Creative Commons Attribution-Share Alike 3.0 Unported License
This is a workflow to automate multiple BLASTp jobs on a large list of protein sequences in FASTA format.
Rating: 5.0 / 5 (1 rating) | Versions: 2 | Reviews: 0 | Comments: 1 | Citations: 0 Viewed: 444 times | Downloaded: 153 times Tags (4): |
View
Download (v2)
|
|
Original Uploader |
Created: 09/01/08 @ 12:03:03 | Last updated: 09/01/08 @ 12:31:27
Credits:
Attributions:
License: Creative Commons Attribution-Share Alike 3.0 Unported License
This workflow performs a generic protein sequence analysis. In order to do that a novel protein sequence enters into the software along with a list of known protein identifiers chosen by the biologist to perform a homology search, followed by a multiple sequence alignment and finally a phylogenetic analysis.
Rating: 4.0 / 5 (2 ratings) | Versions: 1 | Reviews: 0 | Comments: 0 | Citations: 0 Viewed: 1497 times | Downloaded: 404 times Tags (10): |
View
Download (v1)
|
|
Original Uploader |
Created: 03/10/07 @ 18:36:12 | Last updated: 06/03/08 @ 17:01:32 License: Creative Commons Attribution-No Derivative Works 3.0 Unported License
This workflow Performs a blastp search on protein sequence, extracts sequence id within the blast report and retrives the corresponding seuqences.
Rating: 4.0 / 5 (2 ratings) | Versions: 2 | Reviews: 0 | Comments: 2 | Citations: 0 Viewed: 184 times | Downloaded: 55 times Tags (3): |
View
Download (v2)
|
|
Original Uploader |
Created: 31/05/08 @ 14:39:22
Credits:
License: Creative Commons Attribution 3.0 Unported License
Perform a PSI-BLAST iterative search using the EBI’s WSBlastpgp service (see http://www.ebi.ac.uk/Tools/webservices/services/blastpgp). The query sequence, database to search and users e-mail address are inputs, the other parameters for the search (see Job_params) are allowed to default. In most cases you will probably want to adjust the expectation thresholds and the maximum number of iterations for your specific query sequence and the database being searched.
Rating: 0.0 / 5 (0 ratings) | Versions: 1 | Reviews: 0 | Comments: 0 | Citations: 0 Viewed: 121 times | Downloaded: 59 times Tags (7): |
View
Download (v1)
|
|
Original Uploader |
Created: 07/04/09 @ 20:13:19
Credits:
Attributions:
License: Creative Commons Attribution 3.0 Unported License
An implmentation of the classical sequence analysis workflow:
Find homologues (sequence similarity search)
Fetch homologues
Align homologues (multiple sequence alignment)
Produce phylogenetic tree
In this implementation the EBI webservices are used:
WU-BLAST (WSWUBlast) blastp vs. UniProtKB
dbfetch (WSDbfetch)
ClustalW (WSClustalW2)
ClustalW (WSClustalW2)
Note: this version does not add the inital query sequence to the alignment, and so is most useful when used with the identifers...
Rating: 0.0 / 5 (0 ratings) | Versions: 2 | Reviews: 0 | Comments: 0 | Citations: 0 Viewed: 402 times | Downloaded: 133 times Tags (15): |
View
Download (v2)
|
|
Original Uploader |
Created: 30/05/08 @ 22:47:18 | Last updated: 06/12/10 @ 10:51:04
Credits:
License: Creative Commons Attribution 3.0 Unported License
Perform a BLAST search using the EBI's WSWUBlast service (see http://www.ebi.ac.uk/Tools/webservices/services/wublast). The default parameters search UniProtKB using blastp. To change the job parameters see Job_params.
Note: the WSWUBlast service used by this workflow is deprecated as of 21st September 2010 and should not be used in any new development. This service is will be retired during 2011. EBI's replacement WU-BLAST services (REST or SOAP) should be used instead.
Rating: 0.0 / 5 (0 ratings) | Versions: 1 | Reviews: 0 | Comments: 0 | Citations: 0 Viewed: 201 times | Downloaded: 72 times Tags (5): |
View
Download (v1)
|
|
Original Uploader |
Created: 04/07/09 @ 11:39:54 | Last updated: 06/12/10 @ 10:56:44
Credits:
Attributions:
License: Creative Commons Attribution 3.0 Unported License
Run a BLAST analysis using the EBI's WSWUBlast service (see http://www.ebi.ac.uk/Tools/webservices/services/wublast). This workflow wraps the EBI_WU-BLAST workflow to provide a basic user interface which prompts for the required inputs: sequence, database, BLAST program and user e-mail. Other parameters (e.g. matrix, sort, gap penalties, etc.) are allowed to default. The values presented in the selection menus for the program and database are obtained from the service, using the provided me...
Rating: 0.0 / 5 (0 ratings) | Versions: 3 | Reviews: 0 | Comments: 0 | Citations: 0 Viewed: 157 times | Downloaded: 77 times Tags (6): |
View
Download (v3)
|
|
Original Uploader |
Created: 31/05/08 @ 08:38:46 | Last updated: 06/12/10 @ 10:54:16
Credits:
License: Creative Commons Attribution 3.0 Unported License
Perform a BLAST search using the EBI’s WSNCBIBlast service (see http://www.ebi.ac.uk/Tools/webservices/services/ncbiblast). The query sequence, database to search and BLAST program to use are inputs, the other parameters for the search (see Job_params) are allowed to default.
Note: the WSNCBIBlast service used by this workflow is deprecated as of 21st September 2010 and should not be used in any new development. This service is will be retired during 2011. EBI's replacement NCBI BLA...
Rating: 0.0 / 5 (0 ratings) | Versions: 1 | Reviews: 0 | Comments: 1 | Citations: 0 Viewed: 297 times | Downloaded: 149 times Tags (6): |
View
Download (v1)
|
|
Original Uploader |
Created: 31/05/08 @ 08:40:29 | Last updated: 06/12/10 @ 10:55:09
Credits:
Attributions:
License: Creative Commons Attribution 3.0 Unported License
Run a BLAST analysis using the EBI’s WSNCBIBlast service (see http://www.ebi.ac.uk/Tools/webservices/services/ncbiblast). This workflow wraps the EBI_NCBI_BLAST workflow to provide a basic user interface which prompts for the required inputs: sequence, database, BLAST program and user e-mail. Other parameters (e.g. matrix, sort, gap penalties, etc.) are allowed to default.
Note: the WSNCBIBlast service used by this workflow is deprecated as of 21st September 2010 and should not be use...
Rating: 0.0 / 5 (0 ratings) | Versions: 1 | Reviews: 0 | Comments: 0 | Citations: 0 Viewed: 103 times | Downloaded: 68 times Tags (7): |
View
Download (v1)
|
|
Original Uploader |
Created: 09/11/07 @ 10:41:12 | Last updated: 05/06/08 @ 15:18:07
Credits:
License: Creative Commons Attribution-Share Alike 3.0 Unported License
Retrieves a protein sequence in Fasta format from Genbank and then performs a BLAST on that sequence
Rating: 4.0 / 5 (2 ratings) | Versions: 1 | Reviews: 0 | Comments: 0 | Citations: 0 Viewed: 292 times | Downloaded: 13 times Tags (6): |
View
|
|
Original Uploader |
Created: 26/10/08 @ 21:10:09 | Last updated: 01/04/11 @ 08:54:21
Credits:
Attributions:
License: Creative Commons Attribution 3.0 Unported License
Note: the WSInterProScan web service used by this workflow is no longer available haveing been replaced by the EMBL-EBI's InterProScan (REST) (http://www.ebi.ac.uk/Tools/webservices/services/pfa/iprscan_rest) and InterProScan (SOAP) (http://www.ebi.ac.uk/Tools/webservices/services/pfa/iprscan_soap) web services. Thus the workflow described here no longer works, see the alternative workflows for the InterProScan (SOAP) service for workflows which use the new services.
Run InterProScan using a...
Rating: 0.0 / 5 (0 ratings) | Versions: 4 | Reviews: 0 | Comments: 0 | Citations: 0 Viewed: 334 times | Downloaded: 113 times Tags (11): |
View
Download (v4)
|
|
Original Uploader |
Created: 26/10/08 @ 20:45:45 | Last updated: 01/04/11 @ 08:55:49
Credits:
Attributions:
License: Creative Commons Attribution 3.0 Unported License
Note: the WSInterProScan web service used by this workflow is no longer available haveing been replaced by the EMBL-EBI's InterProScan (REST) (http://www.ebi.ac.uk/Tools/webservices/services/pfa/iprscan_rest) and InterProScan (SOAP) (http://www.ebi.ac.uk/Tools/webservices/services/pfa/iprscan_soap) web services. Thus the workflow described here no longer works, see the alternative workflows for the InterProScan (SOAP) service for workflows which use the new services.
Perform a BLAST search a...
Rating: 0.0 / 5 (0 ratings) | Versions: 2 | Reviews: 0 | Comments: 0 | Citations: 0 Viewed: 231 times | Downloaded: 87 times Tags (11): |
View
Download (v2)
|
|
Original Uploader |
Created: 07/06/08 @ 15:05:00 | Last updated: 07/06/08 @ 17:11:36
Credits:
License: Creative Commons Attribution 3.0 Unported License
Perform an NCBI BLAST sequence similarity search using NCBI's QBLAST service (see http://www.ncbi.nlm.nih.gov/BLAST/Doc/urlapi.html). The query sequence, database to search and BLAST program to use are inputs, the other parameters for the search are allowed to default.
Rating: 0.0 / 5 (0 ratings) | Versions: 2 | Reviews: 0 | Comments: 0 | Citations: 0 Viewed: 130 times | Downloaded: 67 times Tags (5): |
View
Download (v2)
|
|
Original Uploader |
Created: 15/10/08 @ 08:43:51 | Last updated: 15/10/08 @ 09:21:35
Credits:
License: Creative Commons Attribution-Share Alike 3.0 Unported License
This workflow invokes the blast service provided at www.bioinformatics.nl, written by Pieter Neerincx. The workflow takes as input a database name (Danio_rerio_Genome for Zebra Fish for example) and a set of sequences in fasta format. The blast service is invoked (using polling) and the result is a tab separated blast report.
To run this workflow, a certificate to access www.bioinformatics.nl needs to installed (Some services use an SSL connection). Look at the link below how to ins...
Rating: 0.0 / 5 (0 ratings) | Versions: 1 | Reviews: 0 | Comments: 0 | Citations: 0 Viewed: 80 times | Downloaded: 35 times Tags (1): |
View
Download (v1)
|
|
Original Uploader |
Created: 03/02/09 @ 08:20:43 | Last updated: 03/02/09 @ 08:28:06
Credits:
License: Creative Commons Attribution-Share Alike 3.0 Unported License
This workflow combines the blat and blast workflows. It takes as input a database name (Danio_rerio_Genome for Zebra Fish for example) and and a set of Fasta sequences. It first tries to perform a blat (at www.bioinformatics.nl). When this service returns nothing, a blast is done (also at www.bioinformatics.nl). The resulting reports are combined.
To run this workflow, a certificate to access www.bioinformatics.nl needs to installed (Some services use an SSL connection). Look at the ...
Rating: 0.0 / 5 (0 ratings) | Versions: 2 | Reviews: 0 | Comments: 0 | Citations: 0 Viewed: 107 times | Downloaded: 52 times Tags (3): |
View
Download (v2)
|
|
Original Uploader |
Created: 28/11/08 @ 15:13:32 | Last updated: 28/11/08 @ 15:34:19
Credits:
License: Creative Commons Attribution 3.0 Unported License
This blastp workflow uses the blast service of MRS (http://mrs.cmbi.ru.nl). Inputs are a sequence (only amino acids, not a fasta sequence) and a database name. Valid database names that can be used are "sprot", "uniprot", "trembl", "pdb", "refseq", "ipi" and "gpcrdb". Output is returned in XML.
Rating: 0.0 / 5 (0 ratings) | Versions: 1 | Reviews: 0 | Comments: 0 | Citations: 0 Viewed: 77 times | Downloaded: 34 times Tags (4): |
View
Download (v1)
|
|
Original Uploader |
Created: 05/12/08 @ 02:57:21
Credits:
Attributions:
License: Creative Commons Attribution-Share Alike 3.0 Unported License
Run a BLAST analysis using the EBI's WSNCBIBlast service (see http://www.ebi.ac.uk/Tools/webservices/services/ncbiblast). This workflow wraps the EBI_NCBI_BLAST workflow to provide a basic user interface which prompts for the required inputs: sequence file, database, BLAST program and user e-mail. Other parameters (e.g. matrix, sort, gap penalties, etc.) are allowed to default.
Rating: 0.0 / 5 (0 ratings) | Versions: 1 | Reviews: 0 | Comments: 0 | Citations: 0 Viewed: 122 times | Downloaded: 81 times Tags (1): |
View
Download (v1)
|
|
Original Uploader |
Created: 13/02/09 @ 09:05:35 | Last updated: 13/02/09 @ 09:08:20
Credits:
Attributions:
License: Creative Commons Attribution-Share Alike 3.0 Unported License
Version info
The former version of the workflow expected that results from BioMART only report transcripts when the query (the probe in our
case) are entirely encapsulated in an exon of that transcript. However, the BioMart service also returns transcripts when the query is not or only partially overlapping with an exon in the stretch on the assembly on which a transcript is defined. This resulted in too many oligos classified as having multiple transcripts or having multiple genes.
...
Rating: 0.0 / 5 (0 ratings) | Versions: 7 | Reviews: 0 | Comments: 0 | Citations: 0 Viewed: 527 times | Downloaded: 97 times Tags (7): |
View
Download (v7)
|
|
Original Uploader |
Created: 20/03/09 @ 15:20:36 | Last updated: 20/03/09 @ 15:22:25
Credits:
License: Creative Commons Attribution-Share Alike 3.0 Unported License
No description
Rating: 0.0 / 5 (0 ratings) | Versions: 1 | Reviews: 0 | Comments: 0 | Citations: 0 Viewed: 161 times | Downloaded: 43 times Tags (6): |
View
Download (v1)
|
|
Original Uploader |
Created: 16/04/09 @ 15:26:57 | Last updated: 01/07/09 @ 08:32:34
Credits:
Attributions:
License: Creative Commons Attribution-Share Alike 3.0 Unported License
This workflow can be downloaded and imported into the BioExtract Server at bioextract.org.
This workflow is a BioExtract Server process similar to the Nucleotide InterProScan workflow designed and implement in Taverna by Hamish McWilliams.
The InterProScan tool (http://www.ebi.ac.uk/Tools/InterProScan/) searches a protein sequence against a selection of protein domain, feature and family signature databases, and integrates the results giving potential assignments to InterPro entries and Gen...
Rating: 0.0 / 5 (0 ratings) | Versions: 3 | Reviews: 0 | Comments: 0 | Citations: 0 Viewed: 146 times | Downloaded: 87 times Tags (5): |
View
Download (v3)
|
|
Original Uploader |
Created: 18/04/08 @ 11:53:19 | Last updated: 18/04/08 @ 11:58:30
Credits:
License: Creative Commons Attribution-Share Alike 3.0 Unported License
This workflow allows you to configure a BioMart query to fetch sequences you want from Ensembl. These sequences are retrieved and a blast database of them is created (by default, in the directory you ran taverna from).
Warning: This workflow assumes that you have blastall and formatdb installed on the machine, and that by default, these are both found or linked in /usr/local/bin. It also assumes that you have write permission to the directory you have run taverna from. The beanshells "creat...
Rating: 0.0 / 5 (0 ratings) | Versions: 1 | Reviews: 0 | Comments: 0 | Citations: 0 Viewed: 230 times | Downloaded: 47 times Tags (1): |
View
Download (v1)
|
|
Original Uploader |
Created: 12/05/10 @ 07:31:32 | Last updated: 12/05/10 @ 07:33:11
Credits:
License: Creative Commons Attribution-Share Alike 3.0 Unported License
There are many kinds of DNA data derived from many species in DDBJ. It makes possible to carry out the comparative study of genes of multiple species. The workflow provides a list of species and their genes that are similar to a human gene in response to a name of the human gene.
Rating: 0.0 / 5 (0 ratings) | Versions: 1 | Reviews: 0 | Comments: 0 | Citations: 0 Viewed: 39 times | Downloaded: 16 times Tags (5): |
View
Download (v1)
|
|
Original Uploader |
Created: 13/05/10 @ 02:11:12 | Last updated: 13/05/10 @ 02:12:28
Credits:
License: Creative Commons Attribution-Share Alike 3.0 Unported License
Execute blastn against DDBJ database with a given DNA sequence and compare the alignment regions of high similar sequences by using ClustalW.
Rating: 0.0 / 5 (0 ratings) | Versions: 1 | Reviews: 0 | Comments: 0 | Citations: 0 Viewed: 43 times | Downloaded: 26 times Tags (4): |
View
Download (v1)
|
|
Original Uploader |
Created: 13/05/10 @ 02:15:45 | Last updated: 13/05/10 @ 02:17:34
Credits:
License: Creative Commons Attribution-Share Alike 3.0 Unported License
You can get three BLAST results against DDBJ, swiss-prot and PDB by using accession number of DDBJ.
Rating: 0.0 / 5 (0 ratings) | Versions: 1 | Reviews: 0 | Comments: 0 | Citations: 0 Viewed: 67 times | Downloaded: 16 times Tags (4): |
View
Download (v1)
|
|
Original Uploader |
Created: 21/07/10 @ 13:16:00 | Last updated: 21/07/10 @ 13:23:12
Credits:
License: Creative Commons Attribution-Share Alike 3.0 Unported License
retrieve protein sequence and do a high speed BLAST and extract position from DDBJ Web services
informations on Web services available at http://xml.nig.ac.jp/index.html
example
accession : Q9NRA8
database : ddbjbct
program : tblastn
param : -b 100 -v 100
Rating: 0.0 / 5 (0 ratings) | Versions: 1 | Reviews: 0 | Comments: 0 | Citations: 0 Viewed: 17 times | Downloaded: 12 times Tags (6): |
View
Download (v1)
|
|
Original Uploader |
Created: 21/07/10 @ 13:24:56 | Last updated: 01/09/10 @ 17:37:48
Credits:
License: Creative Commons Attribution-Share Alike 3.0 Unported License
retrieve protein sequence and do a BLAST with options from DDBJ Web services
informations on Web services available at http://xml.nig.ac.jp/index.html
exxample
accession : Q9NRA8
database : UNIPROT
program : blastp
param : -b 5 -m 7
Rating: 0.0 / 5 (0 ratings) | Versions: 1 | Reviews: 0 | Comments: 0 | Citations: 0 Viewed: 17 times | Downloaded: 10 times Tags (5): |
View
Download (v1)
|
|
Original Uploader |
Created: 21/07/10 @ 13:10:40 | Last updated: 21/07/10 @ 13:10:41
Credits:
Attributions:
License: Creative Commons Attribution-Share Alike 3.0 Unported License
retrieve protein sequence and do a BLAST and extract position from DDBJ Web services
informations on Web services available at http://xml.nig.ac.jp/index.html
example
accession : Q9NRA8
database : UNIPROT
program : blastp
Rating: 0.0 / 5 (0 ratings) | Versions: 1 | Reviews: 0 | Comments: 0 | Citations: 0 Viewed: 17 times | Downloaded: 8 times Tags (6): |
View
Download (v1)
|
|
Original Uploader |
Created: 21/07/10 @ 13:56:08 | Last updated: 21/07/10 @ 13:58:41
Credits:
Attributions:
License: Creative Commons Attribution-Share Alike 3.0 Unported License
retrieve nucleotide sequence and do a BLAST and extract position from DDBJ Web services
informations on Web services available at http://xml.nig.ac.jp/index.html
example :
accession : AB000100
database : DDBJ
program : blastn
Rating: 0.0 / 5 (0 ratings) | Versions: 1 | Reviews: 0 | Comments: 0 | Citations: 0 Viewed: 17 times | Downloaded: 8 times Tags (5): |
View
Download (v1)
|
|
Original Uploader |
Created: 21/07/10 @ 14:08:32 | Last updated: 07/09/10 @ 10:04:55
Credits:
License: Creative Commons Attribution-Share Alike 3.0 Unported License
retrieve nucleotide sequence and do a high speed BLAST and extract position from DDBJ Web services
informations on Web services available at http://xml.nig.ac.jp/index.html
example
accession : AB000100
database : DDBJ
program : blastn
param : -b 5 -m 7
Rating: 0.0 / 5 (0 ratings) | Versions: 4 | Reviews: 0 | Comments: 0 | Citations: 0 Viewed: 28 times | Downloaded: 15 times Tags (5): |
View
Download (v4)
|
|
Original Uploader |
Created: 21/07/10 @ 14:21:50 | Last updated: 21/07/10 @ 14:21:52
Credits:
License: Creative Commons Attribution-Share Alike 3.0 Unported License
retrieve nucleotide sequence and do a BLAST with options from DDBJ Web services
informations on Web services available at http://xml.nig.ac.jp/index.html
example
accession : AB000100
database : DDBJ
program : blastn
param : -b 5 -m 7
Rating: 0.0 / 5 (0 ratings) | Versions: 1 | Reviews: 0 | Comments: 0 | Citations: 0 Viewed: 9 times | Downloaded: 9 times Tags (5): |
View
Download (v1)
|
|
Original Uploader |
Created: 24/08/10 @ 13:45:14 | Last updated: 24/08/10 @ 13:45:16
Credits:
License: Creative Commons Attribution-Share Alike 3.0 Unported License
With this workflow you can submit a BLAST query to the GPCRDB. Input requires a sequence with amino acids only.
Rating: 0.0 / 5 (0 ratings) | Versions: 1 | Reviews: 0 | Comments: 0 | Citations: 0 Viewed: 27 times | Downloaded: 13 times Tags (4): |
View
Download (v1)
|
|
Original Uploader |
Created: 01/09/10 @ 17:16:24 | Last updated: 01/09/10 @ 17:18:45
Credits:
Attributions:
License: Creative Commons Attribution-Share Alike 3.0 Unported License
retrieve protein sequence and do a high speed BLAST from DDBJ Web services
informations on Web services available at http://xml.nig.ac.jp/index.html
example
accession : Q9NRA8
database : ddbjbct
program : tblastn
param : -b 100 -v 100
Rating: 0.0 / 5 (0 ratings) | Versions: 1 | Reviews: 0 | Comments: 0 | Citations: 0 Viewed: 18 times | Downloaded: 12 times Tags (6): |
View
Download (v1)
|
|
Original Uploader |
Created: 01/09/10 @ 17:22:14 | Last updated: 01/09/10 @ 17:22:37
Credits:
Attributions:
License: Creative Commons Attribution-Share Alike 3.0 Unported License
retrieve protein sequence and do a BLAST from DDBJ Web services
informations on Web services available at http://xml.nig.ac.jp/index.html
example
accession : Q9NRA8
database : UNIPROT
program : blastp
Rating: 0.0 / 5 (0 ratings) | Versions: 1 | Reviews: 0 | Comments: 0 | Citations: 0 Viewed: 13 times | Downloaded: 10 times Tags (6): |
View
Download (v1)
|
|
Original Uploader |
Created: 01/09/10 @ 17:26:07 | Last updated: 01/09/10 @ 17:26:39
Credits:
License: Creative Commons Attribution-Share Alike 3.0 Unported License
retrieve nucleotide sequence and do a high speed BLAST from DDBJ Web services
informations on Web services available at http://xml.nig.ac.jp/index.html
accession : AB000100
database : DDBJ
program : blastn
param : -b 5 -m 7
Rating: 0.0 / 5 (0 ratings) | Versions: 1 | Reviews: 0 | Comments: 0 | Citations: 0 Viewed: 9 times | Downloaded: 5 times Tags (5): |
View
Download (v1)
|
|
Original Uploader |
Created: 01/09/10 @ 17:31:29 | Last updated: 01/09/10 @ 17:33:51
Credits:
Attributions:
License: Creative Commons Attribution-Share Alike 3.0 Unported License
retrieve nucleotide sequence and do a BLAST from DDBJ Web services
informations on Web services available at http://xml.nig.ac.jp/index.html
example :
accession : AB000100
database : DDBJ
program : blastn
Rating: 0.0 / 5 (0 ratings) | Versions: 1 | Reviews: 0 | Comments: 0 | Citations: 0 Viewed: 10 times | Downloaded: 7 times Tags (5): |
View
Download (v1)
|
|
Original Uploader |
Created: 22/09/10 @ 12:40:55 | Last updated: 22/09/10 @ 13:35:26
Credits:
License: Creative Commons Attribution-Share Alike 3.0 Unported License
Blast Roche 454 sequences against a reference database on the Dutch Life Science Grid
Conversion of Roche 454 sequences to fasta
Blast sequences against a database
Parse Blast results
http://www.bioinformaticslaboratory.nl/
Rating: 0.0 / 5 (0 ratings) | Versions: 1 | Reviews: 0 | Comments: 0 | Citations: 0 Viewed: 27 times | Downloaded: 14 times Tags (9): |
View
Download (v1)
|
|
Original Uploader |
Created: 22/09/10 @ 13:22:57 | Last updated: 22/09/10 @ 13:36:12
Credits:
License: Creative Commons Attribution-Share Alike 3.0 Unported License
Blast and Blat Roche 454 sequences against a reference database on the Dutch Life Science Grid
Conversion of Roche 454 sequences to fasta
Blat sequences against a database
Blast sequences against a database
Parse Blast results
http://www.bioinformaticslaboratory.nl/
Rating: 0.0 / 5 (0 ratings) | Versions: 1 | Reviews: 0 | Comments: 0 | Citations: 0 Viewed: 31 times | Downloaded: 15 times Tags (10): |
View
Download (v1)
|
|
Original Uploader |
Created: 29/11/10 @ 20:46:58 | Last updated: 29/11/10 @ 20:47:00
Credits:
Attributions:
License: Creative Commons Attribution 3.0 Unported License
Perform a BLAST search using the EMBL-EBI’s NCBI BLAST (SOAP) service (see http://www.ebi.ac.uk/Tools/webservices/services/sss/ncbi_blast_soap). The query sequence, database to search and BLAST program to use are inputs, the other parameters for the search are allowed to default.
Rating: 0.0 / 5 (0 ratings) | Versions: 1 | Reviews: 0 | Comments: 0 | Citations: 0 Viewed: 26 times | Downloaded: 14 times Tags (7): |
View
Download (v1)
|
|
Original Uploader |
Created: 29/11/10 @ 20:03:13 | Last updated: 29/11/10 @ 20:03:14
Attributions:
License: Creative Commons Attribution 3.0 Unported License
Perform a BLAST search using the EMBL-EBI’s NCBI BLAST (SOAP) service (see http://www.ebi.ac.uk/Tools/webservices/services/sss/ncbi_blast_soap). The query sequence, database to search and BLAST program to use are inputs, the other parameters for the search are allowed to default.
Rating: 0.0 / 5 (0 ratings) | Versions: 1 | Reviews: 0 | Comments: 0 | Citations: 0 Viewed: 34 times | Downloaded: 51 times Tags (7): |
View
Download (v1)
|
|
Original Uploader |
Created: 13/12/10 @ 14:41:12 | Last updated: 13/12/10 @ 15:15:45
Attributions:
License: Creative Commons Attribution 3.0 Unported License
Perform Rodent BLAST sequence alignments (using DDBJ Blast) on the gene sequences for a (semi-random) selection of genes from Human sapiens chromosome 22. (Using Biomart)
Referenced in the Taverna knowledge blog.
Rating: 0.0 / 5 (0 ratings) | Versions: 1 | Reviews: 0 | Comments: 0 | Citations: 0 Viewed: 8 times | Downloaded: 7 times Tags (15): |
View
Download (v1)
|
|
Original Uploader |
Created: 13/12/10 @ 14:41:39 | Last updated: 13/12/10 @ 14:47:55
Attributions:
License: Creative Commons Attribution 3.0 Unported License
Perform Rodent BLAST sequence alignments (using DDBJ Blast) on the gene sequences for a (semi-random) selection of genes from Human sapiens chromosome 22. (Using Biomart).
Finally (to showcase Taverna pipelining) - the Ensembl gene ID is added as a prefix on the BLAST report.
Referenced in the Taverna knowledge blog.
Rating: 0.0 / 5 (0 ratings) | Versions: 1 | Reviews: 0 | Comments: 0 | Citations: 0 Viewed: 12 times | Downloaded: 8 times Tags (9): |
View
Download (v1)
|
|
Original Uploader |
Created: 17/01/11 @ 12:51:58 | Last updated: 17/01/11 @ 12:52:03
Credits:
Attributions:
License: Creative Commons Attribution-Share Alike 3.0 Unported License
This workflow performs an NCBI blast at the EBI. It uses the new EBI services, which are asynchronous and require looping over the nested workflow (Status) until the workflow has finished. Many of the EBI services now work in this way, so you can use this workflow as an example of the invocation pattern and looping configuration.
Rating: 0.0 / 5 (0 ratings) | Versions: 1 | Reviews: 0 | Comments: 0 | Citations: 0 Viewed: 61 times | Downloaded: 28 times Tags (13): |
View
Download (v1)
|
|
Original Uploader |
Created: 24/03/11 @ 19:49:43 | Last updated: 01/04/11 @ 12:26:27
Credits:
Attributions:
License: Creative Commons Attribution-Share Alike 3.0 Unported License
The workflow parses uses the tab-delimited BLAST results to determine the unique proteins found in the target genome that have no similarity to the source genome.The workflow parses uses the blast results to determine the unique proteins found in the target genome that have no similairty to the source genome. Using these unique protein ids, and the original target protein fasta file, a fasta file of unique proteins is created.This workflow allows you to configure a BioMart query to fetch sequ...
Rating: 0.0 / 5 (0 ratings) | Versions: 4 | Reviews: 0 | Comments: 0 | Citations: 0 Viewed: 26 times | Downloaded: 17 times Tags (8): |
View
Download (v4)
|
|
Original Uploader |
Created: 25/03/11 @ 20:06:13 | Last updated: 01/04/11 @ 12:40:56
Credits:
License: Creative Commons Attribution-Share Alike 3.0 Unported License
The drug repurposing workflow system screens at least 20 bacterial proteomes against this set of proteins that are already being treated against using established drugs. By screening the bacterial proteomes it will be possible to find proteins of highly similar structure to those that are existing drug protein targets and so this will infer that it is highly likely that the drugs can be used as antimicrobials against these proteins of highly similar structure. Proteomes that will be screene...
Rating: 0.0 / 5 (0 ratings) | Versions: 6 | Reviews: 0 | Comments: 0 | Citations: 0 Viewed: 38 times | Downloaded: 25 times Tags (7): |
View
Download (v6)
|
|
Original Uploader |
Created: 28/03/11 @ 11:57:51 | Last updated: 01/04/11 @ 12:28:38
Credits:
License: Creative Commons Attribution-Share Alike 3.0 Unported License
Thresholds tab-delimited BLAST results to a certain percent identity.
Rating: 0.0 / 5 (0 ratings) | Versions: 2 | Reviews: 0 | Comments: 0 | Citations: 0 Viewed: 11 times | Downloaded: 13 times Tags (5): |
View
Download (v2)
|
|
Original Uploader |
Created: 29/03/11 @ 11:16:17 | Last updated: 30/03/11 @ 16:09:01
Credits:
Attributions:
License: Creative Commons Attribution-Share Alike 3.0 Unported License
Takes in a tab-delimited BLAST file and finds additional information about the target proteins from KEGG, Gene Ontology, Interpro and PubMed.
Rating: 0.0 / 5 (0 ratings) | Versions: 2 | Reviews: 0 | Comments: 0 | Citations: 0 Viewed: 32 times | Downloaded: 16 times Tags (6): |
View
Download (v2)
|
|
Original Uploader |
Created: 18/05/11 @ 15:24:56 | Last updated: 18/05/11 @ 15:39:02
Credits:
License: Creative Commons Attribution-Share Alike 3.0 Unported License
A very simple demo workflow using some existing SADI services. It finds UniProt proteins of GO function "RNA Binding", it then runs a BLAST service to find similar UniProt proteins and then outputs their names.
Rating: 0.0 / 5 (0 ratings) | Versions: 1 | Reviews: 0 | Comments: 0 | Citations: 0 Viewed: 13 times | Downloaded: 6 times Tags (5): |
View
Download (v1)
|
|
Original Uploader |
Created: 19/08/11 @ 10:32:03 | Last updated: 19/08/11 @ 10:41:38
Credits:
License: Creative Commons Attribution-Share Alike 3.0 Unported License
BLAST your sequences against the NucleaRDB. Input requires a sequence with amino acids only (no fasta format etc)
Rating: 0.0 / 5 (0 ratings) | Versions: 1 | Reviews: 0 | Comments: 0 | Citations: 0 Viewed: 16 times | Downloaded: 3 times Tags (4): |
View
Download (v1)
|
|
Original Uploader |
Created: 16/07/11 @ 19:08:38 | Last updated: 16/07/11 @ 19:35:11
Credits:
License: Creative Commons Attribution-Share Alike 3.0 Unported License
This workflow performs multiple sequence similarity searches using the NCBI blast at the EBI. It uses the new EBI services, which are asynchronous and require looping over the nested workflow (Status) until the workflow has finished. Many of the EBI services now work in this way, so you can use this workflow as an example of the invocation pattern and looping configuration.
If you want to make a blast search for more than 10 sequences I would recommend you to run the workflow using the comm...
Rating: 0.0 / 5 (0 ratings) | Versions: 2 | Reviews: 0 | Comments: 0 | Citations: 0 Viewed: 16 times | Downloaded: 9 times Tags (6): |
View
Download (v2)
|
|
Original Uploader |
Created: 13/08/10 @ 14:02:59 | Last updated: 19/11/10 @ 05:32:37
Credits:
License: GNU General Public License (GPL) 2.0
This workflow generates a sequence logo image for a set of amino acid sequences of FOXP2 gene, by downloading the amino acid sequences in Fasta format through Togo Web Service with UniProt identifiers (togoWS, provided by the G-language Genome Analysis Environment SOAP Service), running BLAST web service (runBLAST), retrieving a set of sequences from ID list (togoWS), aligning the sequence with MUSCLE (runMUSCLE), extracting a certain region from the alignment (extractalign, provided by Soapl...
Rating: 0.0 / 5 (0 ratings) | Versions: 2 | Reviews: 0 | Comments: 0 | Citations: 0 Viewed: 30 times | Downloaded: 24 times Tags (9): |
View
Download (v2)
|
|
Creator: |
Created: 11/12/08 @ 12:02:47 | Last updated: 22/01/09 @ 09:06:26
This package contains all elements required to run the RShell use case "Mapping oligonucleotides to an assembly"
5 items in this pack Comments: 0 | Viewed: 156 times | Downloaded: 56 times Tags: |
View
Download
|
Copyright © 2007 - 2011 The University of Manchester and University of Southampton